Anti-DCN Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003315
Article Name: Anti-DCN Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003315
Supplier Catalog Number: HPA003315
Alternative Catalog Number: ATA-HPA003315-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DSPG2, SLRR1B
decorin
Anti-DCN
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1634
UniProt: P07585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DCN
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human ovary and cerebral cortex tissues using Anti-DCN antibody. Corresponding DCN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human ovary shows high expression.
Western blot analysis in human cell line U-2197.
Western blot analysis in control (vector only transfected HEK293T lysate) and DCN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403339).
HPA003315
HPA003315
HPA003315