Anti-MAD2L1

Catalog Number: ATA-HPA003348
Article Name: Anti-MAD2L1
Biozol Catalog Number: ATA-HPA003348
Supplier Catalog Number: HPA003348
Alternative Catalog Number: ATA-HPA003348-100,ATA-HPA003348-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSMAD2, MAD2
MAD2 mitotic arrest deficient-like 1 (yeast)
Anti-MAD2L1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4085
UniProt: Q13257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MAD2L1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA003348-100ul
HPA003348-100ul
HPA003348-100ul