Anti-RPL23

Catalog Number: ATA-HPA003373
Article Name: Anti-RPL23
Biozol Catalog Number: ATA-HPA003373
Supplier Catalog Number: HPA003373
Alternative Catalog Number: ATA-HPA003373-100,ATA-HPA003373-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: L23, rpL17
ribosomal protein L23
Anti-RPL23
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9349
UniProt: P62829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPL23
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA003373-100ul
HPA003373-100ul
HPA003373-100ul