Anti-NDUFV2
Catalog Number:
ATA-HPA003404
- Images (7)
| Article Name: | Anti-NDUFV2 |
| Biozol Catalog Number: | ATA-HPA003404 |
| Supplier Catalog Number: | HPA003404 |
| Alternative Catalog Number: | ATA-HPA003404-100,ATA-HPA003404-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CI-24k |
| NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa |
| Anti-NDUFV2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4729 |
| UniProt: | P19404 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NDUFV2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human kidney shows strong positivity in mitochondria in cells in tubules. |
|
|
Immunohistochemical staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes. |
|
|
Immunohistochemical staining of human testis shows weak to moderate positivity in mitochondria in Leydig cells. |
|
|
Immunohistochemical staining of human soft tissues shows no positivity in fibroblasts. |
|
|
HPA003404-100ul |
|
|
HPA003404-100ul |
|
|
HPA003404-100ul |
Product Guarantee and Expert Support
