Anti-IVNS1ABP
Catalog Number:
ATA-HPA003405
- Images (7)
| Article Name: | Anti-IVNS1ABP |
| Biozol Catalog Number: | ATA-HPA003405 |
| Supplier Catalog Number: | HPA003405 |
| Alternative Catalog Number: | ATA-HPA003405-100,ATA-HPA003405-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP |
| influenza virus NS1A binding protein |
| Anti-IVNS1ABP |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10625 |
| UniProt: | Q9Y6Y0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IVNS1ABP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines U-251MG and PC-3 using Anti-IVNS1ABP antibody. Corresponding IVNS1ABP RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and IVNS1ABP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416621). |
|
|
HPA003405-100ul |
|
|
HPA003405-100ul |
|
|
HPA003405-100ul |
Product Guarantee and Expert Support
