Anti-TFF1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA003425
Article Name: Anti-TFF1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA003425
Supplier Catalog Number: HPA003425
Alternative Catalog Number: ATA-HPA003425-100,ATA-HPA003425-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
trefoil factor 1
Anti-TFF1
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 7031
UniProt: P04155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TFF1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and liver tissues using Anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and A-431 using Anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and TFF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418822).
HPA003425
HPA003425
HPA003425