Anti-RAB5C
Catalog Number:
ATA-HPA003426
- Images (6)
| Article Name: | Anti-RAB5C |
| Biozol Catalog Number: | ATA-HPA003426 |
| Supplier Catalog Number: | HPA003426 |
| Alternative Catalog Number: | ATA-HPA003426-100,ATA-HPA003426-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RAB5CL, RABL |
| RAB5C, member RAS oncogene family |
| Anti-RAB5C |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5878 |
| UniProt: | P51148 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RAB5C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Western blot analysis in human cell lines A-549 and PC-3 using Anti-RAB5C antibody. Corresponding RAB5C RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
HPA003426-100ul |
Product Guarantee and Expert Support
