Anti-LCK

Catalog Number: ATA-HPA003494
Article Name: Anti-LCK
Biozol Catalog Number: ATA-HPA003494
Supplier Catalog Number: HPA003494
Alternative Catalog Number: ATA-HPA003494-100,ATA-HPA003494-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
LCK proto-oncogene, Src family tyrosine kinase
Anti-LCK
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3932
UniProt: P06239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LCK
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-LCK antibody. Corresponding LCK RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA003494-100ul
HPA003494-100ul
HPA003494-100ul