Anti-UBE2J1

Catalog Number: ATA-HPA003509
Article Name: Anti-UBE2J1
Biozol Catalog Number: ATA-HPA003509
Supplier Catalog Number: HPA003509
Alternative Catalog Number: ATA-HPA003509-100,ATA-HPA003509-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-76, HSPC153, NCUBE1, UBC6
ubiquitin-conjugating enzyme E2, J1
Anti-UBE2J1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 51465
UniProt: Q9Y385
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UBE2J1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-UBE2J1 antibody. Corresponding UBE2J1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human lymph node shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and UBE2J1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414230).
HPA003509-100ul
HPA003509-100ul
HPA003509-100ul