Anti-RPLP0

Catalog Number: ATA-HPA003512
Article Name: Anti-RPLP0
Biozol Catalog Number: ATA-HPA003512
Supplier Catalog Number: HPA003512
Alternative Catalog Number: ATA-HPA003512-100,ATA-HPA003512-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: L10E, LP0, P0, PRLP0, RPP0
ribosomal protein, large, P0
Anti-RPLP0
Clonality: Polyclonal
Isotype: IgG
NCBI: 6175
UniProt: P05388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPLP0
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA003512-100ul
HPA003512-100ul
HPA003512-100ul