Anti-CTSH

Catalog Number: ATA-HPA003524
Article Name: Anti-CTSH
Biozol Catalog Number: ATA-HPA003524
Supplier Catalog Number: HPA003524
Alternative Catalog Number: ATA-HPA003524-100,ATA-HPA003524-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACC-4, ACC-5, CPSB
cathepsin H
Anti-CTSH
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1512
UniProt: P09668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTSH
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry analysis in human lung and skeletal muscle tissues using Anti-CTSH antibody. Corresponding CTSH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lung shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA003524-100ul
HPA003524-100ul
HPA003524-100ul