Anti-SEPT3

Catalog Number: ATA-HPA003548
Article Name: Anti-SEPT3
Biozol Catalog Number: ATA-HPA003548
Supplier Catalog Number: HPA003548
Alternative Catalog Number: ATA-HPA003548-100,ATA-HPA003548-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SEP3
septin 3
Anti-SEPT3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 55964
UniProt: Q9UH03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SEPT3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-SEPT3 antibody. Corresponding SEPT3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and LY403438 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403438).
HPA003548-100ul
HPA003548-100ul
HPA003548-100ul