Anti-MRPL58

Catalog Number: ATA-HPA003634
Article Name: Anti-MRPL58
Biozol Catalog Number: ATA-HPA003634
Supplier Catalog Number: HPA003634
Alternative Catalog Number: ATA-HPA003634-100,ATA-HPA003634-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DS-1, ICT1
mitochondrial ribosomal protein L58
Anti-MRPL58
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3396
UniProt: Q14197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MRPL58
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA003634-100ul
HPA003634-100ul
HPA003634-100ul