Anti-DYNC1H1
Catalog Number:
ATA-HPA003742
- Images (6)
| Article Name: | Anti-DYNC1H1 |
| Biozol Catalog Number: | ATA-HPA003742 |
| Supplier Catalog Number: | HPA003742 |
| Alternative Catalog Number: | ATA-HPA003742-100,ATA-HPA003742-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22 |
| dynein, cytoplasmic 1, heavy chain 1 |
| Anti-DYNC1H1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1778 |
| UniProt: | Q14204 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DYNC1H1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA003742-100ul |
|
|
HPA003742-100ul |
|
|
HPA003742-100ul |
Product Guarantee and Expert Support
