Anti-RNGTT
Catalog Number:
ATA-HPA003750
- Images (7)
| Article Name: | Anti-RNGTT |
| Biozol Catalog Number: | ATA-HPA003750 |
| Supplier Catalog Number: | HPA003750 |
| Alternative Catalog Number: | ATA-HPA003750-100,ATA-HPA003750-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | hCAP, HCE, HCE1 |
| RNA guanylyltransferase and 5-phosphatase |
| Anti-RNGTT |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8732 |
| UniProt: | O60942 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RNGTT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells and decidual cells. |
|
|
Western blot analysis in human cell line RH-30. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA003750-100ul |
|
|
HPA003750-100ul |
|
|
HPA003750-100ul |
Product Guarantee and Expert Support
