Anti-FOXP1

Catalog Number: ATA-HPA003876
Article Name: Anti-FOXP1
Biozol Catalog Number: ATA-HPA003876
Supplier Catalog Number: HPA003876
Alternative Catalog Number: ATA-HPA003876-100,ATA-HPA003876-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 12CC4, hFKH1B, HSPC215, QRF1
forkhead box P1
Anti-FOXP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 27086
UniProt: Q9H334
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FOXP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-FOXP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA003876-100ul
HPA003876-100ul
HPA003876-100ul