Anti-PDLIM2
Catalog Number:
ATA-HPA003880
- Images (6)
| Article Name: | Anti-PDLIM2 |
| Biozol Catalog Number: | ATA-HPA003880 |
| Supplier Catalog Number: | HPA003880 |
| Alternative Catalog Number: | ATA-HPA003880-100,ATA-HPA003880-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PDLIM2 |
| PDZ and LIM domain 2 (mystique) |
| Anti-PDLIM2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 64236 |
| UniProt: | Q96JY6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SPGHTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSEG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PDLIM2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites. |
|
|
Immunohistochemical staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA003880-100ul |
|
|
HPA003880-100ul |
|
|
HPA003880-100ul |
Product Guarantee and Expert Support
