Anti-SOX6

Catalog Number: ATA-HPA003908
Article Name: Anti-SOX6
Biozol Catalog Number: ATA-HPA003908
Supplier Catalog Number: HPA003908
Alternative Catalog Number: ATA-HPA003908-100,ATA-HPA003908-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SOX6
SRY (sex determining region Y)-box 6
Anti-SOX6
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55553
UniProt: P35712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SOX6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-SOX6 antibody. Corresponding SOX6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and SOX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403243).
HPA003908-100ul
HPA003908-100ul
HPA003908-100ul