Anti-CDC37

Catalog Number: ATA-HPA003928
Article Name: Anti-CDC37
Biozol Catalog Number: ATA-HPA003928
Supplier Catalog Number: HPA003928
Alternative Catalog Number: ATA-HPA003928-100,ATA-HPA003928-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: P50CDC37
cell division cycle 37
Anti-CDC37
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 11140
UniProt: Q16543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CDC37
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA003928-100ul
HPA003928-100ul
HPA003928-100ul