Anti-MAGEA8

Catalog Number: ATA-HPA003998
Article Name: Anti-MAGEA8
Biozol Catalog Number: ATA-HPA003998
Supplier Catalog Number: HPA003998
Alternative Catalog Number: ATA-HPA003998-100,ATA-HPA003998-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT1.8, MAGE8, MGC2182
melanoma antigen family A, 8
Anti-MAGEA8
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 4107
UniProt: P43361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MAGEA8
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-MAGEA8 antibody. Corresponding MAGEA8 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA003998-100ul
HPA003998-100ul
HPA003998-100ul