Anti-ZNF222

Catalog Number: ATA-HPA004086
Article Name: Anti-ZNF222
Biozol Catalog Number: ATA-HPA004086
Supplier Catalog Number: HPA004086
Alternative Catalog Number: ATA-HPA004086-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZNF222
zinc finger protein 222
Anti-ZNF222
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 7673
UniProt: Q9UK12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AQRKLYRDVMLENFRNLLSVGGKIQTEMETFPEAGTHEEFSCKQIWEQIASDLTRSQDTTISNSQLFEQDDNPSQIKARLSTVHTREKPFQGENCKQFFSDVSFFDLPQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZNF222
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
HPA004086-100ul
HPA004086-100ul
HPA004086-100ul