Anti-DNAAF2
Catalog Number:
ATA-HPA004113
- Images (4)
| Article Name: | Anti-DNAAF2 |
| Biozol Catalog Number: | ATA-HPA004113 |
| Supplier Catalog Number: | HPA004113 |
| Alternative Catalog Number: | ATA-HPA004113-100,ATA-HPA004113-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C14orf104, CILD10, FLJ10563, KTU, PF13 |
| dynein, axonemal, assembly factor 2 |
| Anti-DNAAF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 55172 |
| UniProt: | Q9NVR5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAAF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells and subsets of cells in seminiferus ducts. |
|
|
HPA004113-100ul |
|
|
HPA004113-100ul |
Product Guarantee and Expert Support
