Anti-SUSD2
Catalog Number:
ATA-HPA004117
- Images (6)
| Article Name: | Anti-SUSD2 |
| Biozol Catalog Number: | ATA-HPA004117 |
| Supplier Catalog Number: | HPA004117 |
| Alternative Catalog Number: | ATA-HPA004117-100,ATA-HPA004117-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BK65A6.2, FLJ22778 |
| sushi domain containing 2 |
| Anti-SUSD2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 56241 |
| UniProt: | Q9UGT4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SUSD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human lung and skeletal muscle tissues using Anti-SUSD2 antibody. Corresponding SUSD2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lung shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA004117-100ul |
|
|
HPA004117-100ul |
|
|
HPA004117-100ul |
Product Guarantee and Expert Support
