Anti-AUH
Catalog Number:
ATA-HPA004171
- Images (6)
| Article Name: | Anti-AUH |
| Biozol Catalog Number: | ATA-HPA004171 |
| Supplier Catalog Number: | HPA004171 |
| Alternative Catalog Number: | ATA-HPA004171-100,ATA-HPA004171-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AUH |
| AU RNA binding protein/enoyl-CoA hydratase |
| Anti-AUH |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 549 |
| UniProt: | Q13825 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AUH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-AUH antibody. Corresponding AUH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA004171-100ul |
|
|
HPA004171-100ul |
|
|
HPA004171-100ul |
Product Guarantee and Expert Support
