Anti-GIT1

Catalog Number: ATA-HPA004186
Article Name: Anti-GIT1
Biozol Catalog Number: ATA-HPA004186
Supplier Catalog Number: HPA004186
Alternative Catalog Number: ATA-HPA004186-100,ATA-HPA004186-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GIT1
G protein-coupled receptor kinase interacting ArfGAP 1
Anti-GIT1
Clonality: Polyclonal
Isotype: IgG
NCBI: 28964
UniProt: Q9Y2X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GIT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
HPA004186-100ul
HPA004186-100ul
HPA004186-100ul