Anti-VCAN
Catalog Number:
ATA-HPA004726
- Images (7)
| Article Name: | Anti-VCAN |
| Biozol Catalog Number: | ATA-HPA004726 |
| Supplier Catalog Number: | HPA004726 |
| Alternative Catalog Number: | ATA-HPA004726-100,ATA-HPA004726-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CSPG2, PG-M |
| versican |
| Anti-VCAN |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1462 |
| UniProt: | P13611 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VCAN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil. |
|
|
Immunohistochemical staining of human uterine cervix shows strong positivity in the extracellular matrix. |
|
|
Immunohistochemical staining of human stomach shows moderate positivity in extracellular matrix. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected. |
|
|
HPA004726-100ul |
|
|
HPA004726-100ul |
|
|
HPA004726-100ul |
Product Guarantee and Expert Support
