Anti-UCKL1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004769
Article Name: Anti-UCKL1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004769
Supplier Catalog Number: HPA004769
Alternative Catalog Number: ATA-HPA004769-100,ATA-HPA004769-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20517, URKL1
uridine-cytidine kinase 1-like 1
Anti-UCKL1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 54963
UniProt: Q9NWZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UCKL1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in parietal cells.
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17
Lane 2: Human cell line RT-4
HPA004769
HPA004769
HPA004769