Anti-UCKL1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004769
- Images (9)
| Article Name: | Anti-UCKL1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004769 |
| Supplier Catalog Number: | HPA004769 |
| Alternative Catalog Number: | ATA-HPA004769-100,ATA-HPA004769-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ20517, URKL1 |
| uridine-cytidine kinase 1-like 1 |
| Anti-UCKL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 54963 |
| UniProt: | Q9NWZ5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UCKL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in parietal cells. |
|
|
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17 Lane 2: Human cell line RT-4 |
|
|
HPA004769 |
|
|
|
|
|
HPA004769 |
|
|
HPA004769 |
Product Guarantee and Expert Support
