Anti-MCM3 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004790
Article Name: Anti-MCM3 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004790
Supplier Catalog Number: HPA004790
Alternative Catalog Number: ATA-HPA004790-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MCM3
minichromosome maintenance complex component 3
Anti-MCM3
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4172
UniProt: P25205
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MCM3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & centrosome.
Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA004790
HPA004790
HPA004790