Anti-MELTF Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004880
- Images (11)
| Article Name: | Anti-MELTF Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004880 |
| Supplier Catalog Number: | HPA004880 |
| Alternative Catalog Number: | ATA-HPA004880-100,ATA-HPA004880-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD228, FLJ38863, MAP97, MFI2, MGC4856, MTf, MTF1 |
| melanotransferrin |
| Anti-MELTF |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4241 |
| UniProt: | P08582 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MELTF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human salivary gland and skeletal muscle tissues using HPA004880 antibody. Corresponding MELTF RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human malignant melanoma shows moderate membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes. |
|
|
Immunohistochemical staining of human salivary gland shows moderate positivity in luminal membrane in glandular cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HeLa using Anti-MELTF antibody. Corresponding MELTF RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
HPA004880 |
|
|
|
|
|
HPA004880 |
|
|
HPA004880 |
Product Guarantee and Expert Support
