Anti-MYEF2
Catalog Number:
ATA-HPA004883
- Images (6)
| Article Name: | Anti-MYEF2 |
| Biozol Catalog Number: | ATA-HPA004883 |
| Supplier Catalog Number: | HPA004883 |
| Alternative Catalog Number: | ATA-HPA004883-100,ATA-HPA004883-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ11213, HsT18564, KIAA1341, MEF-2 |
| myelin expression factor 2 |
| Anti-MYEF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 50804 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYEF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA004883-100ul |
|
|
HPA004883-100ul |
|
|
HPA004883-100ul |
Product Guarantee and Expert Support
