Anti-SUGP1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004890
Article Name: Anti-SUGP1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004890
Supplier Catalog Number: HPA004890
Alternative Catalog Number: ATA-HPA004890-100,ATA-HPA004890-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434E2216, F23858, RBP, SF4
SURP and G patch domain containing 1
Anti-SUGP1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 57794
UniProt: Q8IWZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SUGP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SUGP1 antibody. Remaining relative intensity is presented.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA004890
HPA004890
HPA004890