Anti-HNRNPD

Catalog Number: ATA-HPA004911
Article Name: Anti-HNRNPD
Biozol Catalog Number: ATA-HPA004911
Supplier Catalog Number: HPA004911
Alternative Catalog Number: ATA-HPA004911-100,ATA-HPA004911-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AUF1, HNRPD
heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Anti-HNRNPD
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3184
UniProt: Q14103
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HNRNPD
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA004911-100ul
HPA004911-100ul
HPA004911-100ul