Anti-HNF4G
Catalog Number:
ATA-HPA005438
- Images (6)
| Article Name: | Anti-HNF4G |
| Biozol Catalog Number: | ATA-HPA005438 |
| Supplier Catalog Number: | HPA005438 |
| Alternative Catalog Number: | ATA-HPA005438-100,ATA-HPA005438-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NR2A2 |
| hepatocyte nuclear factor 4, gamma |
| Anti-HNF4G |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3174 |
| UniProt: | Q14541 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HNF4G |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-HNF4G antibody. Corresponding HNF4G RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA005438-100ul |
|
|
HPA005438-100ul |
|
|
HPA005438-100ul |
Product Guarantee and Expert Support
