Anti-SEC31A Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005457
Article Name: Anti-SEC31A Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005457
Supplier Catalog Number: HPA005457
Alternative Catalog Number: ATA-HPA005457-100,ATA-HPA005457-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ABP125, ABP130, KIAA0905, SEC31L1
SEC31 homolog A (S. cerevisiae)
Anti-SEC31A
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 22872
UniProt: O94979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SEC31A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.
Immunohistochemical staining of human endometrium shows positivit in glandular cells.
Immunohistochemical staining of human cerebral cortex shows positivity in neurons.
Immunohistochemical staining of human liver shows positivity in hepatocytes.
Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
HPA005457
HPA005457
HPA005457