Anti-SNCA

Catalog Number: ATA-HPA005459
Article Name: Anti-SNCA
Biozol Catalog Number: ATA-HPA005459
Supplier Catalog Number: HPA005459
Alternative Catalog Number: ATA-HPA005459-100,ATA-HPA005459-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: alpha-synuclein, NACP, PARK1, PARK4, PD1
synuclein, alpha (non A4 component of amyloid precursor)
Anti-SNCA
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6622
UniProt: P37840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SNCA
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-SNCA antibody. Corresponding SNCA RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
HPA005459-100ul
HPA005459-100ul
HPA005459-100ul