Anti-ASAH1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005468
Article Name: Anti-ASAH1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005468
Supplier Catalog Number: HPA005468
Alternative Catalog Number: ATA-HPA005468-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AC, ASAH, FLJ21558, PHP32
N-acylsphingosine amidohydrolase (acid ceramidase) 1
Anti-ASAH1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 427
UniProt: Q13510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ASAH1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
HPA005468
HPA005468
HPA005468