Anti-BRIP1
Catalog Number:
ATA-HPA005474
- Images (6)
| Article Name: | Anti-BRIP1 |
| Biozol Catalog Number: | ATA-HPA005474 |
| Supplier Catalog Number: | HPA005474 |
| Alternative Catalog Number: | ATA-HPA005474-100,ATA-HPA005474-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BACH1, FANCJ, OF |
| BRCA1 interacting protein C-terminal helicase 1 |
| Anti-BRIP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 83990 |
| UniProt: | Q9BX63 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BRIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nuclear membrane. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BRIP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA005474-100ul |
|
|
HPA005474-100ul |
|
|
HPA005474-100ul |
Product Guarantee and Expert Support
