Anti-BIRC2
Catalog Number:
ATA-HPA005513
- Images (6)
| Article Name: | Anti-BIRC2 |
| Biozol Catalog Number: | ATA-HPA005513 |
| Supplier Catalog Number: | HPA005513 |
| Alternative Catalog Number: | ATA-HPA005513-100,ATA-HPA005513-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48 |
| baculoviral IAP repeat containing 2 |
| Anti-BIRC2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 329 |
| UniProt: | Q13490 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BIRC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) |
|
|
HPA005513-100ul |
|
|
HPA005513-100ul |
|
|
HPA005513-100ul |
Product Guarantee and Expert Support
