Anti-MEF2C
Catalog Number:
ATA-HPA005533
- Images (10)
| Article Name: | Anti-MEF2C |
| Biozol Catalog Number: | ATA-HPA005533 |
| Supplier Catalog Number: | HPA005533 |
| Alternative Catalog Number: | ATA-HPA005533-100,ATA-HPA005533-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MEF2C |
| myocyte enhancer factor 2C |
| Anti-MEF2C |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4208 |
| UniProt: | Q06413 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MEF2C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MEF2C antibody. Corresponding MEF2C RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and MEF2C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419349). |
|
|
HPA005533-100ul |
|
|
|
|
|
|
|
|
HPA005533-100ul |
|
|
HPA005533-100ul |
Product Guarantee and Expert Support
