Anti-HDHD5

Catalog Number: ATA-HPA005548
Article Name: Anti-HDHD5
Biozol Catalog Number: ATA-HPA005548
Supplier Catalog Number: HPA005548
Alternative Catalog Number: ATA-HPA005548-100,ATA-HPA005548-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CECR5
haloacid dehalogenase like hydrolase domain containing 5
Anti-HDHD5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 27440
UniProt: Q9BXW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HDHD5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA005548-100ul
HPA005548-100ul
HPA005548-100ul