Anti-KEAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-KEAP1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA005558
• Supplier Catalog Number: HPA005558
• Alternative Catalog Number: ATA-HPA005558-100,ATA-HPA005558-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454

Product Description

kelch-like ECH-associated protein 1

Additional Information

Anti-KEAP1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 9817
• UniProt: Q14145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: KEAP1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center.

Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.

HPA005558

HPA005558

HPA005558