Anti-KEAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005558
Article Name: Anti-KEAP1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005558
Supplier Catalog Number: HPA005558
Alternative Catalog Number: ATA-HPA005558-100,ATA-HPA005558-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454
kelch-like ECH-associated protein 1
Anti-KEAP1
Clonality: Polyclonal
Isotype: IgG
NCBI: 9817
UniProt: Q14145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: KEAP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.
HPA005558
HPA005558
HPA005558