Anti-ANLN
Catalog Number:
ATA-HPA005680
- Images (8)
| Article Name: | Anti-ANLN |
| Biozol Catalog Number: | ATA-HPA005680 |
| Supplier Catalog Number: | HPA005680 |
| Alternative Catalog Number: | ATA-HPA005680-100,ATA-HPA005680-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANILLIN, scra, Scraps |
| anillin, actin binding protein |
| Anti-ANLN |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 54443 |
| UniProt: | Q9NQW6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ANLN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ANLN antibody. Corresponding ANLN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANLN antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
HPA005680-100ul |
|
|
|
|
|
HPA005680-100ul |
|
|
HPA005680-100ul |
Product Guarantee and Expert Support
