Anti-PTPA Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005695
Article Name: Anti-PTPA Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005695
Supplier Catalog Number: HPA005695
Alternative Catalog Number: ATA-HPA005695-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PPP2R4, PR53
protein phosphatase 2 phosphatase activator
Anti-PTPA
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5524
UniProt: Q15257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTPA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA005695
HPA005695
HPA005695