Anti-PCP4 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005792
Article Name: Anti-PCP4 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005792
Supplier Catalog Number: HPA005792
Alternative Catalog Number: ATA-HPA005792-100,ATA-HPA005792-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PEP-19
Purkinje cell protein 4
Anti-PCP4
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5121
UniProt: P48539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PCP4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005792 antibody. Corresponding PCP4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity.
Immunofluorescence staining of mouse cerebral cortex shows strong positivity in the deep layers neurons.
Immunofluorescence staining of mouse cerebellum shows strong cytoplasmic positivity in Purkinje cells.
HPA005792
HPA005792
HPA005792