Anti-GRHL1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005798
Article Name: Anti-GRHL1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005798
Supplier Catalog Number: HPA005798
Alternative Catalog Number: ATA-HPA005798-100,ATA-HPA005798-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LBP-32, MGR, TFCP2L2
grainyhead-like 1 (Drosophila)
Anti-GRHL1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 29841
UniProt: Q9NZI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GRHL1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus.
Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
Western blot analysis in human cell line BEWO.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA005798
HPA005798
HPA005798