Anti-PRDM2

Catalog Number: ATA-HPA005809
Article Name: Anti-PRDM2
Biozol Catalog Number: ATA-HPA005809
Supplier Catalog Number: HPA005809
Alternative Catalog Number: ATA-HPA005809-100,ATA-HPA005809-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HUMHOXY1, KMT8, MTB-ZF, RIZ, RIZ1, RIZ2
PR domain containing 2, with ZNF domain
Anti-PRDM2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7799
UniProt: Q13029
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PRDM2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & the Golgi apparatus.
Immunohistochemical staining of human gallbladder shows weak cytoplasmic and nuclear positivity in glandular cells.
HPA005809-100ul
HPA005809-100ul
HPA005809-100ul