Anti-EIF2B2
Catalog Number:
ATA-HPA005841
- Images (8)
| Article Name: | Anti-EIF2B2 |
| Biozol Catalog Number: | ATA-HPA005841 |
| Supplier Catalog Number: | HPA005841 |
| Alternative Catalog Number: | ATA-HPA005841-100,ATA-HPA005841-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EIF-2Bbeta, EIF2B |
| eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa |
| Anti-EIF2B2 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 8892 |
| UniProt: | P49770 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EIF2B2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human thyroid gland and liver tissues using Anti-EIF2B2 antibody. Corresponding EIF2B2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human thyroid gland shows high expression. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
|
|
|
HPA005841-100ul |
|
|
HPA005841-100ul |
|
|
HPA005841-100ul |
Product Guarantee and Expert Support
