Anti-CLIC3 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA005963
Article Name: Anti-CLIC3 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA005963
Supplier Catalog Number: HPA005963
Alternative Catalog Number: ATA-HPA005963-100,ATA-HPA005963-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLIC3
chloride intracellular channel 3
Anti-CLIC3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9022
UniProt: O95833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLIC3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and A-549 using Anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MCF-7
HPA005963
HPA005963