Anti-LRP2
Catalog Number:
ATA-HPA005980
- Images (8)
| Article Name: | Anti-LRP2 |
| Biozol Catalog Number: | ATA-HPA005980 |
| Supplier Catalog Number: | HPA005980 |
| Alternative Catalog Number: | ATA-HPA005980-100,ATA-HPA005980-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DBS, gp330 |
| low density lipoprotein receptor-related protein 2 |
| Anti-LRP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 4036 |
| UniProt: | P98164 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LRP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA005980 antibody. Corresponding LRP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human thyroid gland shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA005980-100ul |
|
|
HPA005980-100ul |
|
|
HPA005980-100ul |
Product Guarantee and Expert Support
