Anti-FLNC

Catalog Number: ATA-HPA006135
Article Name: Anti-FLNC
Biozol Catalog Number: ATA-HPA006135
Supplier Catalog Number: HPA006135
Alternative Catalog Number: ATA-HPA006135-100,ATA-HPA006135-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ABP-280, ABPL, FLN2
filamin C, gamma
Anti-FLNC
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 2318
UniProt: Q14315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FLNC
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-FLNC antibody. Corresponding FLNC RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
HPA006135-100ul
HPA006135-100ul
HPA006135-100ul